Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor 44 (Vmn1r44)

This Recombinant Mouse Vomeronasal type-1 receptor 44 (Vmn1r44) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 44, Vomeronasal type-1 receptor A10, Vomeronasal type-1 receptor B11, Vomeronasal type-1 receptor B4

UniProt

Q9EQ47

Expression Region

1-310

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKANLLHIDTNIKITLLAEVSVGISANSILFIAYLCMLLGENRHKPIDLYIAFLSLTQL MLLITMGLIAVDMFMPWGRWDSTTCQSLIYLHRFLRGLTLCATCLLNVLWTITLSSRNSC LAKFKHKYPHHISGAFLFLCVLYMSFSSHFLVSMTVTPNLTSENFMYVTQSCSLLPMSYS RTSMFSTPVAIRETFLISLMALSSGYMVALLWRHKKQAQHLRSTSLSSKASPEQRATRTI LLLMSFFVVFYILDTVIFHSRMKFKDGSILYCFQIIVSHSYVTVSPFVFICTEKHIIKFL RSMCGRIANI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-500 1x 500 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF488A conjugate, 0.1mg/mL
BNC882375-500 1x 500 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL
BNC401729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL
BNC880818-100 1x 100 µL

CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL
BNC940499-500 1x 500 µL

Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details