Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor 50 (Vmn1r50)

This Recombinant Mouse Vomeronasal type-1 receptor 50 (Vmn1r50) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 50, Pheromone receptor VN2, Vomeronasal receptor 2, Vomeronasal type-1 receptor A5, Vomeronasal type-1 receptor B1

UniProt

Q9EP51

Expression Region

1-310

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKANLLHTDNNMKITLFSEVSVGISANSILFVVHLCKLLHENKPKPIDLYIAFFSITQL MLLITMGLIAVDMFMPWGRWDSTTCQSLIYLHRLLRGLTFCATCLLNVLWTITLSPRSSC LTKFKHKSPHHISGAFLFFCVLYMSFSSHLLVSIIATFNSTSDNFLYVTQSCSILPVSYS RTSILSTMMTMREAFLIGLMALSSGYVVVLLWRHKKQARHLHSTSLSSKASPEQRATSTI MLLMGFFVVLYILDTVIFQARLKFKDVSTFFCVKIIISHSYATFSPFVFICNDKYMIKFV TSMCGRIVNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details