Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51B4 (OR51B4)

This Recombinant Human Olfactory receptor 51B4 (OR51B4) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 51B4, Odorant receptor HOR5'beta1

UniProt

Q9Y5P0

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI IRLFSGQSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOBKL2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV810837 1.0 µg DNA

MOBKL2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KCNMA1 Protein Lysate
OCOA00733-20UG 20 µg

KCNMA1 Protein Lysate

Sign In for Pricing
View Details
Human CD86/ B7-2 ELISA Kit
NS-E10042-01 1 Each

Human CD86/ B7-2 ELISA Kit

Sign In for Pricing
View Details
Human CD86/ B7-2 ELISA Kit
NS-E10042-02 1 Each

Human CD86/ B7-2 ELISA Kit

Sign In for Pricing
View Details
Titin Rabbit Polyclonal Antibody (Cy7)
orb1016837 100 µL

Titin Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2) (FITC)
252602-FITC 100 µL

TGIF2 (TGFB-Induced Factor Homeobox 2) (FITC)

Sign In for Pricing
View Details