Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51B4 (OR51B4)

This Recombinant Human Olfactory receptor 51B4 (OR51B4) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 51B4, Odorant receptor HOR5'beta1

UniProt

Q9Y5P0

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI IRLFSGQSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cc2d1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15152116 3x 1.0 µg

Cc2d1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CTGF Antibody
MBS8516533-01 0.1 mg

CTGF Antibody

Sign In for Pricing
View Details
CTGF Antibody
MBS8516533-02 0.1 mL (AF635)

CTGF Antibody

Sign In for Pricing
View Details
CTGF Antibody
MBS8516533-03 0.1 mL (AF610)

CTGF Antibody

Sign In for Pricing
View Details
CTGF Antibody
MBS8516533-04 0.1 mL (AF405S)

CTGF Antibody

Sign In for Pricing
View Details
CTGF Antibody
MBS8516533-05 0.1 mL (AF405L)

CTGF Antibody

Sign In for Pricing
View Details