Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A25 (OR2A25)

This Recombinant Human Olfactory receptor 2A25 (OR2A25) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A25, Olfactory receptor 2A27

UniProt

A4D2G3

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL KRMLEKKRTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD8 Antibody
8C0359-AAT 50 µg

NEDD8 Antibody

Sign In for Pricing
View Details
Nucleoside Diphosphate Kinase 7 (NME7) (N-term) Rabbit Polyclonal Antibody
AP15032PU-N 400 µL

Nucleoside Diphosphate Kinase 7 (NME7) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GITR Ligand/TNFSF18, Tag Free
HA211265-01 20 µg

Human GITR Ligand/TNFSF18, Tag Free

Sign In for Pricing
View Details
Human GITR Ligand/TNFSF18, Tag Free
HA211265-02 50 µg

Human GITR Ligand/TNFSF18, Tag Free

Sign In for Pricing
View Details
Human GITR Ligand/TNFSF18, Tag Free
HA211265-03 100 µg

Human GITR Ligand/TNFSF18, Tag Free

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]
E-AB-F1120UM-01 25 µg

Elab Fluor® 647 Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody[RB6-8C5]

Sign In for Pricing
View Details