Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A25 (OR2A25)

This Recombinant Human Olfactory receptor 2A25 (OR2A25) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A25, Olfactory receptor 2A27

UniProt

A4D2G3

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL KRMLEKKRTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEV protease Recombinant Protein
TP750187 1 KU

TEV protease Recombinant Protein

Sign In for Pricing
View Details
ProteoSpin Total Protein Concentration, Detergent Clean-Up and Endotoxin Removal Mini Kit
22800 25 Preparations

ProteoSpin Total Protein Concentration, Detergent Clean-Up and Endotoxin Removal Mini Kit

Sign In for Pricing
View Details
p-Cyanobenzoic Acid Trimer
TRC-C955200-500MG 500 mg

p-Cyanobenzoic Acid Trimer

Sign In for Pricing
View Details
CEACAM3 Rabbit Polyclonal Antibody
TA362060 100 µL

CEACAM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phalloidin-iFluor® 680 Conjugate
23128-AAT 300 Tests

Phalloidin-iFluor® 680 Conjugate

Sign In for Pricing
View Details
Mepiquat Chloride
TRC-M225090-250MG 250 mg

Mepiquat Chloride

Sign In for Pricing
View Details