Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A25 (OR2A25)

This Recombinant Human Olfactory receptor 2A25 (OR2A25) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A25, Olfactory receptor 2A27

UniProt

A4D2G3

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL KRMLEKKRTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polycizer 632
TRC-P698970-2.5G 2.5 g

Polycizer 632

Sign In for Pricing
View Details
RBM15 Human Gene Knockout Kit (CRISPR)
KN414777 1 Kit

RBM15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DBNDD1 (NM_001042610) Human Over-expression Lysate
LC421006 20 µg

DBNDD1 (NM_001042610) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Cyclopropyl-8-ethoxy-6,7-difluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid
TRC-C988520-50MG 50 mg

1-Cyclopropyl-8-ethoxy-6,7-difluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Biotin,  15nm
GAB-01-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Biotin, 15nm

Sign In for Pricing
View Details
Human PLA2G2D activation kit by CRISPRa
GA108841 1 Kit

Human PLA2G2D activation kit by CRISPRa

Sign In for Pricing
View Details