Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A4 (OR2A4)

This Recombinant Human Olfactory receptor 2A4 (OR2A4) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A4, Olfactory receptor 2A10, Olfactory receptor OR6-37

UniProt

O95047

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFRTC FSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 Mouse Monoclonal Antibody [Clone ID: OTI6A2]
CF813323 100 µg

CD47 Mouse Monoclonal Antibody [Clone ID: OTI6A2]

Sign In for Pricing
View Details
DHRS7 Human Gene Knockout Kit (CRISPR)
KN400017 1 Kit

DHRS7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cdh10 Mouse Gene Knockout Kit (CRISPR)
KN502999 1 Kit

Cdh10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Atherin (SAMD1) Human Gene Knockout Kit (CRISPR)
KN416678 1 Kit

Atherin (SAMD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Triosephosphate Isomerase Antibody
RC-15048-01 50 μL

Recombinant Triosephosphate Isomerase Antibody

Sign In for Pricing
View Details
Recombinant Triosephosphate Isomerase Antibody
RC-15048-02 100 µL

Recombinant Triosephosphate Isomerase Antibody

Sign In for Pricing
View Details