Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1496 (Olr1496)

This Recombinant Rat Olfactory receptor 1496 (Olr1496) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 1496, Olfactory receptor-like protein I3

UniProt

P23269

Expression Region

1-310

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNQTFITQFLLLGLPIPEEHQHLFYALFLVMYLTTILGNLLIIVLVQLDSQLHTPMYLF LSNLSFSDLCFSSVTMPKLLQNMRSQDTSIPYGGCLAQTYFFMVFGDMESFLLVAMAYDR YVAICFPLHYTSIMSPKLCTCLVLLLWMLTTSHAMMHTLLAARLSFCENNVVLNFFCDLF VLLKLACSDTYINELMIFIMSTLLIIIPFFLIVMSYARIISSILKVPSTQGICKVFSTCG SHLSVVSLFYGTIIGLYLCPAGNNSTVKEMVMAMMYTVVTPMLNPFIYSLRNRDMKRALI RVICSMKITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740731-100 1x 100 µL

AMACR / p504S (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details