Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G1 (OR8G1)

This Recombinant Human Olfactory receptor 8G1 (OR8G1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 8G1, Olfactory receptor OR11-281, Olfactory receptor TPCR25

UniProt

Q15617

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGENNSSVTEFILAGLSEQPELQLPLFLLFLGIYVVTVVGNLGMTTLIWLSSHLHTPMY YFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY DRYMAICSPLLYSVIISNKACFSLILGVYIIGLVCASVHTGCMFRVQFCKFDLINHYFCD LLPLLKLSCSSIYVNKLLILCVGAFNILVPSLTILCSYIFIIASILHIRSTEGRSKAFST CSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTIIVPMLNPLIYSLRNKDVHVS LKKMLQRRTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Staurosporine * 1 mM DMSO stock solution*
80050-AAT 100 µL

ReadiUse™ Staurosporine * 1 mM DMSO stock solution*

Sign In for Pricing
View Details
Renalase (RNLS) (NM_018363) Human Recombinant Protein
TP320551L 1 mg

Renalase (RNLS) (NM_018363) Human Recombinant Protein

Sign In for Pricing
View Details
Adam32 Mouse Gene Knockout Kit (CRISPR)
KN500836 1 Kit

Adam32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45 / LCA (2B11), 1mg/mL
BNUM0470-50 1x 50 µL

CD45 / LCA (2B11), 1mg/mL

Sign In for Pricing
View Details
25-HVD3 (25-Hydroxy Vitamin D3) ELISA Kit
E-EL-0015-01 24 Tests

25-HVD3 (25-Hydroxy Vitamin D3) ELISA Kit

Sign In for Pricing
View Details
25-HVD3 (25-Hydroxy Vitamin D3) ELISA Kit
E-EL-0015-02 48 Tests

25-HVD3 (25-Hydroxy Vitamin D3) ELISA Kit

Sign In for Pricing
View Details