Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 9 (TAS2R9)

This Recombinant Papio hamadryas Taste receptor type 2 member 9 (TAS2R9) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 9, T2R9

UniProt

Q646G5

Expression Region

1-311

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSTIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDVSLIDIILISLAISRICLLC VISLDGFFILLFPGTYDINVLESIMDAVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF WLKLKINKVILAILLGSFLISLIISFPINGXWYHLFKVSHEENITWAFKVSTIPGAFKQL TLNLGAMVPFMLCLISFFLLLFSLVRHTKQIQLHATGLRDPSTEAHMRAIKAVIIFLLLL IVYYPVFLVMTSSTLIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFVK GFLRRRKPFGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL
BNC401927-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details