Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 149 (Olfr149)

This Recombinant Mouse Olfactory receptor 149 (Olfr149) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 149, Odorant receptor M31, Olfactory receptor 224-8, Olfactory receptor 7G

UniProt

Q60888

Expression Region

1-311

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLSVVTQFILLGIPHTEGVETMLFVLFFSFYIFTLVGNLLILLAIVSSSRLHTPMYFF LCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTECFLYTVMAYDR FVAICYPLRYSVIMSHRICAFLAMGTAVFGCIHSTFLTTLTFQLPYCGPKDVNYYFCDIP VVMKLACADTSTLEMVGFISVGLMPLSCFFFILTSYSCIVRSILQIRSTEGRHRAFSTCS AHFTAILLFYMPVIFIYLRPTPSPWLDATVQILNNLVTPMLNPLIYSLRNKEVKSSLWTV LHLLCFLPKHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tick-Borne Encephalitis Virus NS3
MBS143151-01 0.1 mg

Recombinant Tick-Borne Encephalitis Virus NS3

Sign In for Pricing
View Details
Recombinant Tick-Borne Encephalitis Virus NS3
MBS143151-02 0.5 mg

Recombinant Tick-Borne Encephalitis Virus NS3

Sign In for Pricing
View Details
Recombinant Tick-Borne Encephalitis Virus NS3
MBS143151-03 1 mg

Recombinant Tick-Borne Encephalitis Virus NS3

Sign In for Pricing
View Details
Recombinant Tick-Borne Encephalitis Virus NS3
MBS143151-04 5x 1 mg

Recombinant Tick-Borne Encephalitis Virus NS3

Sign In for Pricing
View Details
PTPN22 (NM_012411) Human Tagged ORF Clone Lentiviral Particle
RC215662L4V 200 µL

PTPN22 (NM_012411) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cckbr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6789205 3x 1.0 µg

Cckbr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details