Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Taste receptor type 2 member 9 (TAS2R9)

This Recombinant Macaca mulatta Taste receptor type 2 member 9 (TAS2R9) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 9, T2R9

UniProt

Q645T0

Expression Region

1-311

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSTIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDVSLIDIILISLAISRICLLC VISLDGFFILLFPGTYDTNVLESIMDAVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF WLKLKINKVILAILLGSFLISLIISFPINGMWYNLFKVSHEENITWAFKVSTIPGAFKQL TLNLGAMVPFILCLISFFLLLFSLVRHTKQIQLHATGFRDPSTEAHMRAVKAVIIFLLLL ILYYPVFLVMTSSTLIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLRAAFLKMLRFVK GFLRRRKPFVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (C5/473), CF640R conjugate, 0.1mg/mL
BNC400473-100 1x 100 µL

CD5 (C5/473), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF488A conjugate, 0.1mg/mL
BNC880448-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details