Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana CAAX prenyl protease 2 (FACE2)

This Recombinant Arabidopsis thaliana CAAX prenyl protease 2 (FACE2) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

CAAX prenyl protease 2, EC= 3.4.22.-, Farnesylated proteins-converting enzyme 2, AtFACE-2, Prenyl protein-specific endoprotease 2, Protein RAS-CONVERTING ENZYME 1

UniProt

Q8GW19

Expression Region

1-311

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDGESISMSLAVATCVAMALFYVLILYVPTVILRLPSASSYTEFMIRRFICAAICTVA SLVFTAFILPIKSWEASYILGVYGIRKDHLWQGVVYPLLLTSLVYAGSLVLKLFTLLESW KENGGGCSSFNYIRSFFQTIPASVLTSASNVSVWRNFIVAPVTEELVFRSCMIPLLLCAG FRINTAIFLCPVLFSLAHLNHFREMYIRHNRSYLRASLIVGLQLGYTVIFGAYASFLFIR TGHLAAPLFAHIFCNYMGLPVLYANGKGLVSAAFLGGVVGFVLLLFPLTKPLMYNDSTND CPCWLGYCLWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF488A conjugate, 0.1mg/mL
BNC881897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF647 conjugate, 0.1mg/mL
BNC472207-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (CDK1/873), CF647 conjugate, 0.1mg/mL
BNC470873-100 1x 100 µL

P34 / cdk1 (CDK1/873), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details