Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8H1 (OR8H1)

This Recombinant Human Olfactory receptor 8H1 (OR8H1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 8H1, Olfactory receptor OR11-180

UniProt

Q8NGG4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRRNNTNVPDFILTGLSDSEEVQMALFILFLLIYLITMLGNVGMILIIRLDLQLHTPMY FFLTHLSFIDLSYSTVITPKTLANLLTSNYISFMGCFAQMFFFVFLGAAECFLLSSMAYD RYVAICSPLRYPVIMSKRLCCALVTGPYVISFINSFVNVVWMSRLHFCDSNVVRHFFCDT SPILALSCMDTYDIEIMIHILAGSTLMVSLITISASYVSILSTILKINSTSGKQKALSTC ASHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL IRVMQRRQDSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D2 (CCND2/2620), CF594 conjugate, 0.1mg/mL
BNC942620-100 1x 100 µL

Cyclin D2 (CCND2/2620), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM229A (Center) Rabbit Polyclonal Antibody
AP54194PU-N 400 µL

TMEM229A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRRK2 Antibody
KC-8366-01 50 μL

LRRK2 Antibody

Sign In for Pricing
View Details
LRRK2 Antibody
KC-8366-02 100 µL

LRRK2 Antibody

Sign In for Pricing
View Details
LRRK2 Antibody
KC-8366-03 1 mL

LRRK2 Antibody

Sign In for Pricing
View Details
Human SPEGNB activation kit by CRISPRa
GA119423 1 Kit

Human SPEGNB activation kit by CRISPRa

Sign In for Pricing
View Details