Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8H1 (OR8H1)

This Recombinant Human Olfactory receptor 8H1 (OR8H1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 8H1, Olfactory receptor OR11-180

UniProt

Q8NGG4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRRNNTNVPDFILTGLSDSEEVQMALFILFLLIYLITMLGNVGMILIIRLDLQLHTPMY FFLTHLSFIDLSYSTVITPKTLANLLTSNYISFMGCFAQMFFFVFLGAAECFLLSSMAYD RYVAICSPLRYPVIMSKRLCCALVTGPYVISFINSFVNVVWMSRLHFCDSNVVRHFFCDT SPILALSCMDTYDIEIMIHILAGSTLMVSLITISASYVSILSTILKINSTSGKQKALSTC ASHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL IRVMQRRQDSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Muricholic Acid
TRC-M732755-1MG 1 mg

Beta-Muricholic Acid

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), 1 mg/mL
BNUM1927-50 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), 1 mg/mL

Sign In for Pricing
View Details
MAGI3 Human Gene Knockout Kit (CRISPR)
KN418925 1 Kit

MAGI3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TrueBlack® WB Blocking Buffer: (500mL)
#23013A-500ML 1x 500 mL

TrueBlack® WB Blocking Buffer: (500mL)

Sign In for Pricing
View Details
WNT5A Rabbit Monoclonal Antibody [Clone ID: 23GB2400]
TA425339 100 µL

WNT5A Rabbit Monoclonal Antibody [Clone ID: 23GB2400]

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF405S conjugate, 0.1mg/mL
BNC041192-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details