Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M4 (OR2M4)

This Recombinant Human Olfactory receptor 2M4 (OR2M4) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 2M4, HTPCRX18, OST710, Olfactory receptor OR1-55, Olfactory receptor TPCR100

UniProt

Q96R27

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMY FLLSQLSLMDLMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAY DRYVAICHPLQYTILMNPKLCVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCD VAALLPLSCTETSAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTT CSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTILTPMLNPLIYSLRNKEVFRA LQKVLKKRKLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Over-expression Lysate
LC400260 20 µg

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Over-expression Lysate

Sign In for Pricing
View Details
CMPK2 Antibody
KC-1599-01 50 μL

CMPK2 Antibody

Sign In for Pricing
View Details
CMPK2 Antibody
KC-1599-02 100 µL

CMPK2 Antibody

Sign In for Pricing
View Details
CMPK2 Antibody
KC-1599-03 1 mL

CMPK2 Antibody

Sign In for Pricing
View Details
BDH2 (NM_020139) Human Over-expression Lysate
LC402755 20 µg

BDH2 (NM_020139) Human Over-expression Lysate

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), 1mg/mL
BNUM1985-50 1x 50 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), 1mg/mL

Sign In for Pricing
View Details