Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M4 (OR2M4)

This Recombinant Human Olfactory receptor 2M4 (OR2M4) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 2M4, HTPCRX18, OST710, Olfactory receptor OR1-55, Olfactory receptor TPCR100

UniProt

Q96R27

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMY FLLSQLSLMDLMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAY DRYVAICHPLQYTILMNPKLCVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCD VAALLPLSCTETSAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTT CSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTILTPMLNPLIYSLRNKEVFRA LQKVLKKRKLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VIM Antibody
F48163-0.4ML 0.4 mL

VIM Antibody

Sign In for Pricing
View Details
Automatic Gasoline Oxidation Stability Tester (Induction Period Method) BPTL-266
BPTL-266 1 Unit

Automatic Gasoline Oxidation Stability Tester (Induction Period Method) BPTL-266

Sign In for Pricing
View Details
NHEDC2 (SLC9B2) (NM_001300754) Human Tagged ORF Clone
RG238478 10 µg

NHEDC2 (SLC9B2) (NM_001300754) Human Tagged ORF Clone

Sign In for Pricing
View Details
GSK3α/β (Ab-279/216) Antibody
8B0012-AAT 50 µg

GSK3α/β (Ab-279/216) Antibody

Sign In for Pricing
View Details
2-Bromo-2-(2-fluorophenyl)-1-cyclopropylethanone (90% purity)
TRC-B688795-5G 5 g

2-Bromo-2-(2-fluorophenyl)-1-cyclopropylethanone (90% purity)

Sign In for Pricing
View Details
CYP20A1 Rabbit Polyclonal Antibody
TA362310 100 µL

CYP20A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details