Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5L2 (OR5L2)

This Recombinant Human Olfactory receptor 5L2 (OR5L2) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5L2, HTPCRX16, Olfactory receptor OR11-153

UniProt

Q8NGL0

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMTALIQVSSRLHTPVY FFLSHLSFVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCGVTEVFLLAVMAY DRFVAICNPLLYMVTMSQKLRVELTSCCYFCGTVCSLIHSSLALRILFYRSNVINHFFCD LPPLLSLACSDVTVNETLLFLVATLNESVTIMIILTSYLLILTTILKIHSAESRHKAFST CASHLTAITVSHGTILYIYCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKA LRKVMGSKIHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-4'-chlorodiphenyl Sulfone
TRC-A603775-1G 1 g

4-Amino-4'-chlorodiphenyl Sulfone

Sign In for Pricing
View Details
SLUG Antibody
F47912-0.4ML 0.4 mL

SLUG Antibody

Sign In for Pricing
View Details
Rabbit anti-Aspartoacylase Antibody
YLD0622-01 50 µL

Rabbit anti-Aspartoacylase Antibody

Sign In for Pricing
View Details
Rabbit anti-Aspartoacylase Antibody
YLD0622-02 100 µL

Rabbit anti-Aspartoacylase Antibody

Sign In for Pricing
View Details
MRPL18 Rabbit pAb
E45R22824N-100 100 µL

MRPL18 Rabbit pAb

Sign In for Pricing
View Details
BC051665 (NM_199148) Mouse Tagged ORF Clone Lentiviral Particle
MR204864L3V 200 µL

BC051665 (NM_199148) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details