Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5L2 (OR5L2)

This Recombinant Human Olfactory receptor 5L2 (OR5L2) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5L2, HTPCRX16, Olfactory receptor OR11-153

UniProt

Q8NGL0

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMTALIQVSSRLHTPVY FFLSHLSFVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCGVTEVFLLAVMAY DRFVAICNPLLYMVTMSQKLRVELTSCCYFCGTVCSLIHSSLALRILFYRSNVINHFFCD LPPLLSLACSDVTVNETLLFLVATLNESVTIMIILTSYLLILTTILKIHSAESRHKAFST CASHLTAITVSHGTILYIYCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKA LRKVMGSKIHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF7, CT (ZNF7, KOX4, Zinc finger protein 7, Zinc finger protein HF.16, Zinc finger protein KOX4) (Biotin)
MBS6367506-01 0.2 mL

ZNF7, CT (ZNF7, KOX4, Zinc finger protein 7, Zinc finger protein HF.16, Zinc finger protein KOX4) (Biotin)

Sign In for Pricing
View Details
ZNF7, CT (ZNF7, KOX4, Zinc finger protein 7, Zinc finger protein HF.16, Zinc finger protein KOX4) (Biotin)
MBS6367506-02 5x 0.2 mL

ZNF7, CT (ZNF7, KOX4, Zinc finger protein 7, Zinc finger protein HF.16, Zinc finger protein KOX4) (Biotin)

Sign In for Pricing
View Details
STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (HRP)
MBS6155224-01 0.1 mL

STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (HRP)

Sign In for Pricing
View Details
STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (HRP)
MBS6155224-02 5x 0.1 mL

STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) (HRP)

Sign In for Pricing
View Details
Monkey Ceroid lipofuscinosis neuronal protein 5 (CLN5) ELISA Kit
GTR10327718 96 Well

Monkey Ceroid lipofuscinosis neuronal protein 5 (CLN5) ELISA Kit

Sign In for Pricing
View Details
LGALS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
26465061 1.0 µg DNA

LGALS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details