Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G5 (OR8G5)

This Recombinant Human Olfactory receptor 8G5 (OR8G5) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 8G5, Olfactory receptor 8G6, Olfactory receptor OR11-298

UniProt

Q8NG78

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAENHSFVTKFILVGLTEKSELQLPLFLVFLGIYVVTVLGNLGMITLIGLSSHLHTPMY CFLSSLSFIDFCHSTVITPKMLVNFVTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAY DGYVAICSPLLYSIIISNKACFSLILVVYVIGLICASAHIGCMFRVQFCKFDVINHYFCD LISILKLSCSSTYINELLILIFSGINILVPSLTILSSYIFIIASILRIRYTEGRSKAFST CSSHISAVSVFFGSAAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVHVA LKKTLGKRTFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8/803), 0.2mg/mL
BNUB0803-100 1x 100 µL

Cytokeratin 8 (KRT8/803), 0.2mg/mL

Sign In for Pricing
View Details
Human DEFB107B activation kit by CRISPRa
GA118600 1 Kit

Human DEFB107B activation kit by CRISPRa

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP06341PU-N 100 µg

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sall1 Mouse Gene Knockout Kit (CRISPR)
KN515265 1 Kit

Sall1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Factor H (CFH) Human Gene Knockout Kit (CRISPR)
KN220707LP 1 Kit

Factor H (CFH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(Z)-13-Octadecenal
TRC-O235500-2.5MG 2.5 mg

(Z)-13-Octadecenal

Sign In for Pricing
View Details