Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1L4 (OR1L4)

This Recombinant Human Olfactory receptor 1L4 (OR1L4) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 1L4, OST046, Olfactory receptor 1L5, Olfactory receptor 9-E, OR9-E, Olfactory receptor OR9-29

UniProt

Q8NGR5

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPM YFFLSNLSFMDICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMA IDRLVAICNPLHYDVVMKPWHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFC DTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCTIFSYLQIIVTVLRIPSAAGKWKAFS TCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKR GLKKLRHRIYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Specific Antigen (LN-5), 1mg/mL
BNUM0059-50 1x 50 µL

Macrophage Specific Antigen (LN-5), 1mg/mL

Sign In for Pricing
View Details
Tsg101 Mouse Gene Knockout Kit (CRISPR)
KN518331 1 Kit

Tsg101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSMB3 Rabbit Polyclonal Antibody
TA365974 100 µL

PSMB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE Anti-Human CD72 Antibody[3F3]
AN00325D-01 20 Tests

PE Anti-Human CD72 Antibody[3F3]

Sign In for Pricing
View Details
PE Anti-Human CD72 Antibody[3F3]
AN00325D-02 100 Tests

PE Anti-Human CD72 Antibody[3F3]

Sign In for Pricing
View Details
PE Anti-Human CD72 Antibody[3F3]
AN00325D-03 2x 100 Tests

PE Anti-Human CD72 Antibody[3F3]

Sign In for Pricing
View Details