Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K1 (OR4K1)

This Recombinant Human Olfactory receptor 4K1 (OR4K1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 4K1, Olfactory receptor OR14-19

UniProt

Q8NGD4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHTNESMVSEFVLLGLSNSWGLQLFFFAIFSIVYVTSVLGNVLIIVIISFDSHLNSPMY FLLSNLSFIDICQSNFATPKMLVDFFIERKTISFEGCMAQIFVLHSFVGSEMMLLVAMAY DRFIAICKPLHYSTIMNRRLCVIFVSISWAVGVLHSVSHLAFTVDLPFCGPNEVDSFFCD LPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYTIILIGVRCRSSSGSSKALSTL TAHITVVILFFGPCIYFYIWPFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWK LRNRHVNSWKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS704048 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
HRP Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-
H-5701-1 1 mg

HRP Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-

Sign In for Pricing
View Details
EXTL1 (NM_004455) Human Recombinant Protein
TP309064L 1 mg

EXTL1 (NM_004455) Human Recombinant Protein

Sign In for Pricing
View Details
Rat GAL7 (Galectin 7) CLIA Kit
E-CL-R0265-01 24 Tests

Rat GAL7 (Galectin 7) CLIA Kit

Sign In for Pricing
View Details
Rat GAL7 (Galectin 7) CLIA Kit
E-CL-R0265-02 48 Tests

Rat GAL7 (Galectin 7) CLIA Kit

Sign In for Pricing
View Details
Rat GAL7 (Galectin 7) CLIA Kit
E-CL-R0265-03 96 Tests

Rat GAL7 (Galectin 7) CLIA Kit

Sign In for Pricing
View Details