Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K1 (OR4K1)

This Recombinant Human Olfactory receptor 4K1 (OR4K1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 4K1, Olfactory receptor OR14-19

UniProt

Q8NGD4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHTNESMVSEFVLLGLSNSWGLQLFFFAIFSIVYVTSVLGNVLIIVIISFDSHLNSPMY FLLSNLSFIDICQSNFATPKMLVDFFIERKTISFEGCMAQIFVLHSFVGSEMMLLVAMAY DRFIAICKPLHYSTIMNRRLCVIFVSISWAVGVLHSVSHLAFTVDLPFCGPNEVDSFFCD LPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYTIILIGVRCRSSSGSSKALSTL TAHITVVILFFGPCIYFYIWPFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWK LRNRHVNSWKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISCU (NM_014301) Human Recombinant Protein
TP312031M 100 µg

ISCU (NM_014301) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF640R conjugate, 0.1mg/mL
BNC401877-100 1x 100 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: B-T7]
AM31241PU-N 2 mL (200 Tests)

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: B-T7]

Sign In for Pricing
View Details
NAT2 (C-term) Rabbit Polyclonal Antibody
AP17579PU-N 400 µL

NAT2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Glutathione Peroxidase (GPX) Activity Assay Kit
E-BC-K809-M-01 48 T (46 samples)

Cell Glutathione Peroxidase (GPX) Activity Assay Kit

Sign In for Pricing
View Details
Cell Glutathione Peroxidase (GPX) Activity Assay Kit
E-BC-K809-M-02 96 T (94 samples)

Cell Glutathione Peroxidase (GPX) Activity Assay Kit

Sign In for Pricing
View Details