Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5P3 (OR5P3)

This Recombinant Human Olfactory receptor 5P3 (OR5P3) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5P3, Olfactory receptor OR11-94, Olfactory receptor-like protein JCG1

UniProt

Q8WZ94

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAY DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD YSPLLKLACSHDFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGA LKRELRIKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IRF7 Antibody [DyLight 405]
NBP3-06987V 0.1 mL

Rabbit Polyclonal IRF7 Antibody [DyLight 405]

Sign In for Pricing
View Details
HOXB2 Antibody
A44187-100UL 100 µL

HOXB2 Antibody

Sign In for Pricing
View Details
Phf23 Antibody
GWB-MS178G 50 µg

Phf23 Antibody

Sign In for Pricing
View Details
cpl-1 (Mature-region) Rabbit Polyclonal Antibody
AP54829PU-N 100 µg

cpl-1 (Mature-region) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse ZNF3 (KIAA4229), Rabbit Polyclonal
MKA4229 Inquire

Anti-Mouse ZNF3 (KIAA4229), Rabbit Polyclonal

Sign In for Pricing
View Details
Porcine growth hormone releasing hormone, GHRH ELISA Kit
CK-bio-17698-01 48 Tests

Porcine growth hormone releasing hormone, GHRH ELISA Kit

Sign In for Pricing
View Details