Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5P3 (OR5P3)

This Recombinant Human Olfactory receptor 5P3 (OR5P3) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5P3, Olfactory receptor OR11-94, Olfactory receptor-like protein JCG1

UniProt

Q8WZ94

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAY DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD YSPLLKLACSHDFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGA LKRELRIKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HUS1B shRNA (UAS) - Lentiviral human HUS1B shRNA (UAS, iRFP) (25)
GTR15108818 1 Vial

Lentiviral human HUS1B shRNA (UAS) - Lentiviral human HUS1B shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse Anti-Biotin-FITC
6404-02 0.5 mg

Mouse Anti-Biotin-FITC

Sign In for Pricing
View Details
PPFIA1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1695006 1.0 µg DNA

PPFIA1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
anti-HP1 alpha
YF-PA25897 50 ul

anti-HP1 alpha

Sign In for Pricing
View Details
Recombinant Human NaPi2b (C-6His-Flag)
C27K-01 10 µg

Recombinant Human NaPi2b (C-6His-Flag)

Sign In for Pricing
View Details
Recombinant Human NaPi2b (C-6His-Flag)
C27K-02 50 µg

Recombinant Human NaPi2b (C-6His-Flag)

Sign In for Pricing
View Details