Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5P3 (OR5P3)

This Recombinant Human Olfactory receptor 5P3 (OR5P3) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5P3, Olfactory receptor OR11-94, Olfactory receptor-like protein JCG1

UniProt

Q8WZ94

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAY DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD YSPLLKLACSHDFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGA LKRELRIKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis3 (m) -PR
sc-149364-PR 10 µM - 20 µL

Meis3 (m) -PR

Sign In for Pricing
View Details
PDE, BioAssayTM Kit (Phosphodiesterases) discontinued
137322 96 Tests

PDE, BioAssayTM Kit (Phosphodiesterases) discontinued

Sign In for Pricing
View Details
Anti-GCN2/EIF2AK4 Antibody Picoband® (Biotine Conjugate)
PA2028-Biotin 100 µg/Vial

Anti-GCN2/EIF2AK4 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
T2R46 siRNA (h)
sc-106592 10 µM

T2R46 siRNA (h)

Sign In for Pricing
View Details
ColorTag pipette marking rings, for all Eppendorf pipettes, fits pipette upper part or 2 mL pipette lower part, neon blue, inner diameter: 24 mm, 10 pcs.
4031-6610 10 PCS

ColorTag pipette marking rings, for all Eppendorf pipettes, fits pipette upper part or 2 mL pipette lower part, neon blue, inner diameter: 24 mm, 10 pcs.

Sign In for Pricing
View Details
SFRS17A Rabbit Polyclonal Antibody (BF647)
orb2457164 100 µL

SFRS17A Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details