Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D11 (OR4D11)

This Recombinant Human Olfactory receptor 4D11 (OR4D11) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 4D11

UniProt

Q8NGI4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR LKRRLVPSERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pQE-50 Plasmid
PVT0528 2 µg

pQE-50 Plasmid

Sign In for Pricing
View Details
Ypel5 (NM_027166) Mouse Tagged ORF Clone
MR200584 10 µg

Ypel5 (NM_027166) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Gtf2h5 3'UTR GFP Stable Cell Line
TU159208 1.0 mL

Gtf2h5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
1-{[4- (4-Fluorophenyl) piperazin-1-yl]methyl}cyclopropan-1-amine
MJC90536-01 50 mg

1-{[4- (4-Fluorophenyl) piperazin-1-yl]methyl}cyclopropan-1-amine

Sign In for Pricing
View Details
1-{[4- (4-Fluorophenyl) piperazin-1-yl]methyl}cyclopropan-1-amine
MJC90536-02 0.5 g

1-{[4- (4-Fluorophenyl) piperazin-1-yl]methyl}cyclopropan-1-amine

Sign In for Pricing
View Details
RNASE9 (NM_001110356) Human Tagged ORF Clone Lentiviral Particle
RC225233L3V 200 µL

RNASE9 (NM_001110356) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details