Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D11 (OR4D11)

This Recombinant Human Olfactory receptor 4D11 (OR4D11) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 4D11

UniProt

Q8NGI4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR LKRRLVPSERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIST Lentiviral Activation Particles (h2)
sc-404939-LAC-2 200 µL

PIST Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
HIGD2A (NM_138820) Human Over-expression Lysate
LS192286-20ug 20 µg

HIGD2A (NM_138820) Human Over-expression Lysate

Sign In for Pricing
View Details
Dusp11 Blocking Peptide
33R-3510 100 ug

Dusp11 Blocking Peptide

Sign In for Pricing
View Details
TRUB1 (NM_139169) Human Over-expression Lysate
LC408372 20 µg

TRUB1 (NM_139169) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Myostatin
7-01276 2 µg

Recombinant Human Myostatin

Sign In for Pricing
View Details
Goat RING Finger Protein 11 (RNF11) ELISA Kit
MBS9393144 Inquire

Goat RING Finger Protein 11 (RNF11) ELISA Kit

Sign In for Pricing
View Details