Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D11 (OR4D11)

This Recombinant Human Olfactory receptor 4D11 (OR4D11) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 4D11

UniProt

Q8NGI4

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR LKRRLVPSERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE2 (Isoform C) (C-term) Rabbit Polyclonal Antibody
AP13070PU-N 400 µL

BACE2 (Isoform C) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ACADSB sgRNA gene knockout kit - Lentiviral human ACADSB sgRNA gene knockout kit (25)
GTR15401271 1 Vial

Lentiviral human ACADSB sgRNA gene knockout kit - Lentiviral human ACADSB sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rat Monoclonal NTNG1 Antibody (RM0292-4K62) [PerCP]
NBP2-11810PCP 0.1 mL

Rat Monoclonal NTNG1 Antibody (RM0292-4K62) [PerCP]

Sign In for Pricing
View Details
YTHDC1 Antibody, Biotin conjugated
A65472-50UG 50 µg

YTHDC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Nfkbil1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7129508 1.0 µg DNA

Nfkbil1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-Hu CD195 Purified CCR5 Monoclonal Antibody
M00061 0.1 mg

Anti-Hu CD195 Purified CCR5 Monoclonal Antibody

Sign In for Pricing
View Details