Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein lifeguard 3 (TMBIM1)

This Recombinant Human Protein lifeguard 3 (TMBIM1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1

UniProt

Q969X1

Expression Region

1-311

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPT HPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF TFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTG TISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIV LYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIF TFVLQLMGDRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SATB1 Human Gene Knockout Kit (CRISPR)
KN400421 1 Kit

SATB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Fructose 1-Phosphate Sodium Salt
TRC-F894940-25MG 25 mg

L-Fructose 1-Phosphate Sodium Salt

Sign In for Pricing
View Details
Spike S1 RBD, Avi-His-tag, Biotin-labeled (SARS-CoV-2) Recombinant
100697-1 25 µg

Spike S1 RBD, Avi-His-tag, Biotin-labeled (SARS-CoV-2) Recombinant

Sign In for Pricing
View Details
Anti-His-tag | 3xHis (polyclonal) - DyLight® 650 conjugated (40 µg)
AS20 4441-DL650 40 µg

Anti-His-tag | 3xHis (polyclonal) - DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
PIST (GOPC) Rabbit Polyclonal Antibody
TA376681 100 µL

PIST (GOPC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAP1 Human Gene Knockout Kit (CRISPR)
KN201394 1 Kit

CAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details