Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein lifeguard 3 (TMBIM1)

This Recombinant Human Protein lifeguard 3 (TMBIM1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1

UniProt

Q969X1

Expression Region

1-311

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPT HPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF TFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTG TISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIV LYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIF TFVLQLMGDRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NFKBID activation kit by CRISPRa
GA113699 1 Kit

Human NFKBID activation kit by CRISPRa

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF740 conjugate, 0.1mg/mL
BNC742673-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2673), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF594 conjugate, 0.1mg/mL
BNC941497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stathmin 1 (STMN1) (NM_203399) Human Over-expression Lysate
LC404338 20 µg

Stathmin 1 (STMN1) (NM_203399) Human Over-expression Lysate

Sign In for Pricing
View Details
C18orf54 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]
TA808319BM 100 µL

C18orf54 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
DPP3 Rabbit Polyclonal Antibody
TA375596 100 µL

DPP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details