Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein lifeguard 3 (TMBIM1)

This Recombinant Human Protein lifeguard 3 (TMBIM1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1

UniProt

Q969X1

Expression Region

1-311

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPT HPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF TFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTG TISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIV LYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIF TFVLQLMGDRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Osteoprotegerin / TNFRSF11B, C-His Tag
HA210977-01 Inquire

Human Osteoprotegerin / TNFRSF11B, C-His Tag

Sign In for Pricing
View Details
Human Osteoprotegerin / TNFRSF11B, C-His Tag
HA210977-02 50 µg

Human Osteoprotegerin / TNFRSF11B, C-His Tag

Sign In for Pricing
View Details
Human Osteoprotegerin / TNFRSF11B, C-His Tag
HA210977-03 100 µg

Human Osteoprotegerin / TNFRSF11B, C-His Tag

Sign In for Pricing
View Details
NECAP2 (NM_001145278) Human Over-expression Lysate
LY428782 100 µg

NECAP2 (NM_001145278) Human Over-expression Lysate

Sign In for Pricing
View Details
Epitope Tag Antibody Sampler Kit
HAK21016 1 Kit

Epitope Tag Antibody Sampler Kit

Sign In for Pricing
View Details
MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody
AP13022PU-N 400 µL

MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details