Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A5 (OR2A5)

This Recombinant Human Olfactory receptor 2A5 (OR2A5) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 2A5, Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141, OR7-138, OR7-141

UniProt

Q96R48

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWLDSRLHTPMYF FLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQTFLYMAFAHTECLILVMMSY DRYMAICHPLQYSVIMRWGVCTVLAVTSWACGSLLALVHVVLILRLPFCGPHEINHFFCE ILSVLKLACADTWLNQVVIFAASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFST CSSHLCMVGLFFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGA LKRVLWKQRSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF488 Anti-Mouse CD16/32 Antibody
RD20164F-01 25 µg

AF488 Anti-Mouse CD16/32 Antibody

Sign In for Pricing
View Details
AF488 Anti-Mouse CD16/32 Antibody
RD20164F-02 100 µg

AF488 Anti-Mouse CD16/32 Antibody

Sign In for Pricing
View Details
PCTAIRE2 (CDK17) (NM_001170464) Human Over-expression Lysate
LC433226 20 µg

PCTAIRE2 (CDK17) (NM_001170464) Human Over-expression Lysate

Sign In for Pricing
View Details
CDK5RAP3 (NM_001278217) Human Tagged ORF Clone
RG238117 10 µg

CDK5RAP3 (NM_001278217) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mitochondrial Marker (MTC02), 0.2mg/mL
BNUB0740-500 1x 500 µL

Mitochondrial Marker (MTC02), 0.2mg/mL

Sign In for Pricing
View Details
Human TMEM98 activation kit by CRISPRa
GA108701 1 Kit

Human TMEM98 activation kit by CRISPRa

Sign In for Pricing
View Details