Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A5 (OR2A5)

This Recombinant Human Olfactory receptor 2A5 (OR2A5) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 2A5, Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141, OR7-138, OR7-141

UniProt

Q96R48

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWLDSRLHTPMYF FLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQTFLYMAFAHTECLILVMMSY DRYMAICHPLQYSVIMRWGVCTVLAVTSWACGSLLALVHVVLILRLPFCGPHEINHFFCE ILSVLKLACADTWLNQVVIFAASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFST CSSHLCMVGLFFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGA LKRVLWKQRSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF814 Human Gene Knockout Kit (CRISPR)
KN427196 1 Kit

ZNF814 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLCO2B1 Human Gene Knockout Kit (CRISPR)
KN207759 1 Kit

SLCO2B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE Anti-Human CD90 Antibody[5E10]
E-AB-F1167D-01 20 Tests

PE Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
PE Anti-Human CD90 Antibody[5E10]
E-AB-F1167D-02 100 Tests

PE Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
PE Anti-Human CD90 Antibody[5E10]
E-AB-F1167D-03 2x 100 Tests

PE Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
NFKB1 Rabbit Polyclonal Antibody
AP02562PU-N 100 µL

NFKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details