Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AN1 (OR5AN1)

This Recombinant Human Olfactory receptor 5AN1 (OR5AN1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5AN1, Olfactory receptor OR11-244

UniProt

Q8NGI8

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGGGNITEITYFILLGFSDFPRIIKVLFTIFLVIYITSLAWNLSLIVLIRMDSHLHTPM YFFLSNLSFIDVCYISSTVPKMLSNLLQEQQTITFVGCIIQYFIFSTMGLSESCLMTAMA YDRYAAICNPLLYSSIMSPTLCVWMVLGAYMTGLTASLFQIGALLQLHFCGSNVIRHFFC DMPQLLILSCTDTFFVQVMTAILTMFFGIASALVIMISYGYIGISIMKITSAKGRSKAFN TCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD ALKRLQKRKCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decladinose Roxithromycin (Roxithromycin Impurity B)
TRC-D226800-25MG 25 mg

Decladinose Roxithromycin (Roxithromycin Impurity B)

Sign In for Pricing
View Details
RDH11 (NM_016026) Human Over-expression Lysate
LC402488 20 µg

RDH11 (NM_016026) Human Over-expression Lysate

Sign In for Pricing
View Details
DGKZ Antibody
KC-1252-01 50 μL

DGKZ Antibody

Sign In for Pricing
View Details
DGKZ Antibody
KC-1252-02 100 µL

DGKZ Antibody

Sign In for Pricing
View Details
DGKZ Antibody
KC-1252-03 1 mL

DGKZ Antibody

Sign In for Pricing
View Details
PPIH Human Gene Knockout Kit (CRISPR)
KN401529 1 Kit

PPIH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details