Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10G4 (OR10G4)

This Recombinant Human Olfactory receptor 10G4 (OR10G4) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 10G4, Olfactory receptor OR11-278

UniProt

Q8NGN3

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD RYLAISYPLRYTSMMSGSRCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA PPILKLACADTSANVMVIFVDIGIVASGCFVLIVLSYVSIVCSILRIRTSDGRRRAFQTC ASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK LRDKVAHPQRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS712265 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
3,5-Xylenol Phosphate
TRC-X749550-10G 10 g

3,5-Xylenol Phosphate

Sign In for Pricing
View Details
Caspase 10 (CASP10) Rabbit Polyclonal Antibody
AP06036PU-N 100 µg

Caspase 10 (CASP10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DOK1 (NM_001381) Human Over-expression Lysate
LY419987 100 µg

DOK1 (NM_001381) Human Over-expression Lysate

Sign In for Pricing
View Details
SSBP4 (NM_001009998) Human Over-expression Lysate
LY423175 100 µg

SSBP4 (NM_001009998) Human Over-expression Lysate

Sign In for Pricing
View Details
Wfdc8 Mouse Gene Knockout Kit (CRISPR)
KN519421 1 Kit

Wfdc8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details