Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10G4 (OR10G4)

This Recombinant Human Olfactory receptor 10G4 (OR10G4) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 10G4, Olfactory receptor OR11-278

UniProt

Q8NGN3

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD RYLAISYPLRYTSMMSGSRCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA PPILKLACADTSANVMVIFVDIGIVASGCFVLIVLSYVSIVCSILRIRTSDGRRRAFQTC ASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK LRDKVAHPQRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803128 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
PPP4R1L Antibody
8C18661-AAT 50 µg

PPP4R1L Antibody

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-01 48 T (32 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-02 96 T (80 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details
GNPAT (NM_014236) Human Over-expression Lysate
LY402292 100 µg

GNPAT (NM_014236) Human Over-expression Lysate

Sign In for Pricing
View Details
IMP3 Polyclonal Antibody
E-AB-40171-01 25 µL

IMP3 Polyclonal Antibody

Sign In for Pricing
View Details