Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF1

This Recombinant Dog Olfactory receptor-like protein OLF1 spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF1

UniProt

Q95154

Expression Region

1-311

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGNYTLVTEFILLGFPTRPELQIVLFLVFLTLYGIILTGNIGLMMLIRTDPHLQTPMYF FLSNLSFADLCFSSAIVPKMLVNFLSENKSISLYGCALQFYFSCAFADTESFILAAMAYD RYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFILKYCDKNVINHFFCDL PPLLKLSCTDTSVNEWLLSTYGSSVEIFCFIVIVISYYFILRSVLRIRSSSGRKKTFSTC ASHLTSVAIYQGTLLFIYSRPTYLYTPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAA KRAVRLKVDSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epsilon Dipeptide
TRC-E592296-250MG 250 mg

Epsilon Dipeptide

Sign In for Pricing
View Details
Mouse Epm2a activation kit by CRISPRa
GA201270 1 Kit

Mouse Epm2a activation kit by CRISPRa

Sign In for Pricing
View Details
Human DEFB134 activation kit by CRISPRa
GA118644 1 Kit

Human DEFB134 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ANKRD20A3P activation kit by CRISPRa
GA118505 1 Kit

Human ANKRD20A3P activation kit by CRISPRa

Sign In for Pricing
View Details
IKK beta (IKBKB) Rabbit Polyclonal Antibody
AP06526PU-N 100 µg

IKK beta (IKBKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD79B Mouse Monoclonal Antibody [Clone ID: OTI2B6]
CF810463 100 µg

CD79B Mouse Monoclonal Antibody [Clone ID: OTI2B6]

Sign In for Pricing
View Details