Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF1

This Recombinant Dog Olfactory receptor-like protein OLF1 spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF1

UniProt

Q95154

Expression Region

1-311

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGNYTLVTEFILLGFPTRPELQIVLFLVFLTLYGIILTGNIGLMMLIRTDPHLQTPMYF FLSNLSFADLCFSSAIVPKMLVNFLSENKSISLYGCALQFYFSCAFADTESFILAAMAYD RYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFILKYCDKNVINHFFCDL PPLLKLSCTDTSVNEWLLSTYGSSVEIFCFIVIVISYYFILRSVLRIRSSSGRKKTFSTC ASHLTSVAIYQGTLLFIYSRPTYLYTPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAA KRAVRLKVDSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF320 (NM_207333) Human Over-expression Lysate
LC403960 20 µg

ZNF320 (NM_207333) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta Arrestin 2 (ARRB2) (NM_199004) Human Over-expression Lysate
LY430785 100 µg

Beta Arrestin 2 (ARRB2) (NM_199004) Human Over-expression Lysate

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF594 conjugate, 0.1mg/mL
BNC940024-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hoechst 33342 maleimide
17672-AAT 1 mg

Hoechst 33342 maleimide

Sign In for Pricing
View Details
UCHL3 Rabbit Monoclonal Antibody
TA424256 100 µL

UCHL3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AdrenomeduLlin (ADM) (NM_001124) Human Over-expression Lysate
LY420111 100 µg

AdrenomeduLlin (ADM) (NM_001124) Human Over-expression Lysate

Sign In for Pricing
View Details