Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF1

This Recombinant Dog Olfactory receptor-like protein OLF1 spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF1

UniProt

Q95154

Expression Region

1-311

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGNYTLVTEFILLGFPTRPELQIVLFLVFLTLYGIILTGNIGLMMLIRTDPHLQTPMYF FLSNLSFADLCFSSAIVPKMLVNFLSENKSISLYGCALQFYFSCAFADTESFILAAMAYD RYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFILKYCDKNVINHFFCDL PPLLKLSCTDTSVNEWLLSTYGSSVEIFCFIVIVISYYFILRSVLRIRSSSGRKKTFSTC ASHLTSVAIYQGTLLFIYSRPTYLYTPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAA KRAVRLKVDSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Repirinast (>80%)
TRC-R144560-10MG 10 mg

Repirinast (>80%)

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15B2]
TA801288AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15B2]

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF640R conjugate, 0.1mg/mL
BNC401660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant TRAPPC2 Antibody
RC-5954-01 50 μL

Recombinant TRAPPC2 Antibody

Sign In for Pricing
View Details
Recombinant TRAPPC2 Antibody
RC-5954-02 100 µL

Recombinant TRAPPC2 Antibody

Sign In for Pricing
View Details
Recombinant TRAPPC2 Antibody
RC-5954-03 1 mL

Recombinant TRAPPC2 Antibody

Sign In for Pricing
View Details