Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C3 (OR6C3)

This Recombinant Human Olfactory receptor 6C3 (OR6C3) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 6C3, HSA8

UniProt

Q9NZP0

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFL RNFSFLEISFTTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRY VAICKPLHYTSIMNRKLCTLLVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFP LLQLSCSDTWLLEVIGFYFALVTLLFTLALVILSYMYIIRTILRIPSASQRKKAFSTCSS HMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAPMLNPFIYTLRNQQVKQAFKN VVHKVVFYANQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADIPOQ Polyclonal Antibody
E-AB-40301-01 25 µL

ADIPOQ Polyclonal Antibody

Sign In for Pricing
View Details
ADIPOQ Polyclonal Antibody
E-AB-40301-02 100 µL

ADIPOQ Polyclonal Antibody

Sign In for Pricing
View Details
Transmembrane Protein 175 (TMEM175) (NM_001297426) Human Tagged ORF Clone
RG237906 10 µg

Transmembrane Protein 175 (TMEM175) (NM_001297426) Human Tagged ORF Clone

Sign In for Pricing
View Details
C16orf9 (FAM234A) Human Gene Knockout Kit (CRISPR)
KN402291 1 Kit

C16orf9 (FAM234A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat CASP3 protein (His tag)
PDER100193-01 20 µg

Recombinant Rat CASP3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CASP3 protein (His tag)
PDER100193-02 100 µg

Recombinant Rat CASP3 protein (His tag)

Sign In for Pricing
View Details