Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1D4 (OR1D4)

This Recombinant Human Olfactory receptor 1D4 (OR1D4) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 1D4, Olfactory receptor 17-30, OR17-30

UniProt

P47884

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCD MYILLWLACSNTHIIHTALIATGCFIFLTLLGFMTTSYVRIVRTILQMPSASKKYKTFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYSLRNKDMHGAP GRVLWRPFQRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICAM1 Antibody Picoband® (monoclonal, 6F2C3) (Dylight488 Conjugate)
M00171-3-Dylight488 100 µg

Anti-ICAM1 Antibody Picoband® (monoclonal, 6F2C3) (Dylight488 Conjugate)

Sign In for Pricing
View Details
Anti-Squid ADAR1 Antibody
MBS1759640-01 0.2 mL

Anti-Squid ADAR1 Antibody

Sign In for Pricing
View Details
Anti-Squid ADAR1 Antibody
MBS1759640-02 0.1 mg (Carrier Free)

Anti-Squid ADAR1 Antibody

Sign In for Pricing
View Details
Anti-Squid ADAR1 Antibody
MBS1759640-03 0.2 mL (Biotin)

Anti-Squid ADAR1 Antibody

Sign In for Pricing
View Details
Anti-Squid ADAR1 Antibody
MBS1759640-04 0.2 mL (HRP)

Anti-Squid ADAR1 Antibody

Sign In for Pricing
View Details
Anti-Squid ADAR1 Antibody
MBS1759640-05 0.2 mL (FITC)

Anti-Squid ADAR1 Antibody

Sign In for Pricing
View Details