Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1073 (Olr1073)

This Recombinant Rat Olfactory receptor 1073 (Olr1073) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 1073, Putative gustatory receptor PTE45

UniProt

P35898

Expression Region

1-311

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQQNDTQILQFLLLGLSENTELQPLIYWLFFSMYLVTVWGNLIIILATVLDFRLHTAMY FFLCNLSFVDICLISTTIPKMLANVHLNHKAITYEGCIMQIYFFTLFVGLDNFLLAVMAY DRFVAICHPLRYTSIMTPHLCMSLVLVSWIASVLNSSLQSFLVLQLSFCTEVEIPHFFCE LSMLVHLACSDTFLSDMAMNVLAALLGGGCLVGILYSYSKIVSSIQAISSAEGKYKAFST CVSHLSVVSLFYCTLLGVYLSSAVTQNSHSTAATSLMYTVVTPMLNPFIYSLRNDNIKRA LKNFVKKKLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD12 Antibody
OAAN01963-200UL 200 µL

PSMD12 Antibody

Sign In for Pricing
View Details
CD1d Polyclonal Antibody, PE Conjugated
bs-4961R-PE 100 µL

CD1d Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Human DCUN1D1, GST-tagged
DCUN1D1-11871H 25 µg

Recombinant Human DCUN1D1, GST-tagged

Sign In for Pricing
View Details
CAT ELISA Kit (Mouse)
OKCD08120-96W 96 Well

CAT ELISA Kit (Mouse)

Sign In for Pricing
View Details
FXYD2 Protein Vector (Mouse) (pPB-N-His)
PV180655 500 ng

FXYD2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Phospho-EPHA2/3 (Tyr588/596) Antibody
E18-0028-2 100 µg -100 µL

Phospho-EPHA2/3 (Tyr588/596) Antibody

Sign In for Pricing
View Details