Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1073 (Olr1073)

This Recombinant Rat Olfactory receptor 1073 (Olr1073) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 1073, Putative gustatory receptor PTE45

UniProt

P35898

Expression Region

1-311

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQQNDTQILQFLLLGLSENTELQPLIYWLFFSMYLVTVWGNLIIILATVLDFRLHTAMY FFLCNLSFVDICLISTTIPKMLANVHLNHKAITYEGCIMQIYFFTLFVGLDNFLLAVMAY DRFVAICHPLRYTSIMTPHLCMSLVLVSWIASVLNSSLQSFLVLQLSFCTEVEIPHFFCE LSMLVHLACSDTFLSDMAMNVLAALLGGGCLVGILYSYSKIVSSIQAISSAEGKYKAFST CVSHLSVVSLFYCTLLGVYLSSAVTQNSHSTAATSLMYTVVTPMLNPFIYSLRNDNIKRA LKNFVKKKLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488-conjugated beta Tubulin Monoclonal Antibody
AN00293L-01 25 µL

Elab Fluor® 488-conjugated beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488-conjugated beta Tubulin Monoclonal Antibody
AN00293L-02 100 µL

Elab Fluor® 488-conjugated beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)
MBS4516629-01 20 Tests

Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)
MBS4516629-02 50 Tests

Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)
MBS4516629-03 100 Tests

Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)
MBS4516629-04 5x 100 Tests

Anti-Human CD49d Monoclonal Antibody (PE/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details