Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 287 (Olr287)

This Recombinant Rat Olfactory receptor 287 (Olr287) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 287, Olfactory receptor-like protein F6

UniProt

P23267

Expression Region

1-311

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWSTGQNLSTPGPFILLGFPGPRSMRIGLFLLFLVMYLLTVVGNLAIISLVGAHRCLQT PMYFFLCNLSFLEIWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFSLGCTEYFLLAV MAYDRYLAICLPLRYGGIMTPGLAMRLALGSWLCGFSAITVPATLIARLSFCGSRVINHF FCDISPWIVLSCTDTQVVELVSFGIAFCVILGSCGITLVSYAYIITTIIKIPSARGRHRA FSTCSSHLTVVLIWYGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDV KEALRRTVKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC25 activation kit by CRISPRa
GA110639 1 Kit

Human CCDC25 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB617332 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
Human SLC35F4 activation kit by CRISPRa
GA117525 1 Kit

Human SLC35F4 activation kit by CRISPRa

Sign In for Pricing
View Details
DNMT3L Mouse Monoclonal Antibody [Clone ID: N117/9]
75-153 100 µL

DNMT3L Mouse Monoclonal Antibody [Clone ID: N117/9]

Sign In for Pricing
View Details
Vertical Autoclave BAVT-401-C
BAVT-401-C 1 Unit

Vertical Autoclave BAVT-401-C

Sign In for Pricing
View Details
IL-4 (Interleukin-4), Mouse (11B11), Biotin conjugate, 0.1mg/mL
BNCB2008-500 1x 500 µL

IL-4 (Interleukin-4), Mouse (11B11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details