Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Probable membrane protein (BILF1)

This Recombinant Epstein-Barr virus Probable membrane protein (BILF1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Probable membrane protein

UniProt

P03208

Expression Region

1-312

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLLVLLILLTLAGILFIIF VRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLTQNMMFLGLMCSVWTHLGMAL EKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLITMGPDANLNRGPNMCREGPTK GMHTAVQGLKAGCYLLAAVLIVLLTVIIIWKLLRTKFGRKPRLICNVTFTGLICAFSWFM LSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLALLLIILYAWSFSHFMDSLKNQVTVT ARYFRRVPSQST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHIT Polyclonal Antibody
E-AB-11235-01 20 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details
FHIT Polyclonal Antibody
E-AB-11235-02 60 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details
FHIT Polyclonal Antibody
E-AB-11235-03 120 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details
FHIT Polyclonal Antibody
E-AB-11235-04 200 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details
FGR Antibody
8C10321-AAT 50 µg

FGR Antibody

Sign In for Pricing
View Details
Cyclophilin 40 (PPID) (NM_005038) Human Over-expression Lysate
LC401561 20 µg

Cyclophilin 40 (PPID) (NM_005038) Human Over-expression Lysate

Sign In for Pricing
View Details