Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Probable membrane protein (BILF1)

This Recombinant Epstein-Barr virus Probable membrane protein (BILF1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Probable membrane protein

UniProt

P03208

Expression Region

1-312

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLLVLLILLTLAGILFIIF VRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLTQNMMFLGLMCSVWTHLGMAL EKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLITMGPDANLNRGPNMCREGPTK GMHTAVQGLKAGCYLLAAVLIVLLTVIIIWKLLRTKFGRKPRLICNVTFTGLICAFSWFM LSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLALLLIILYAWSFSHFMDSLKNQVTVT ARYFRRVPSQST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS507698 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Alpha-Synuclein Recombinant Rabbit monoclonal Antibody
HA751248 100 µL

Alpha-Synuclein Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GPS2 Antibody
8C15826-AAT 50 µg

GPS2 Antibody

Sign In for Pricing
View Details
c-Myc (MYC) pThr58 Rabbit Polyclonal Antibody
AP02335PU-S 50 µL

c-Myc (MYC) pThr58 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD137, Mouse (LOB12), Biotin conjugate, 0.1mg/mL
BNCB2012-500 1x 500 µL

CD137, Mouse (LOB12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N WASP (WASL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]
TA811282BM 100 µL

N WASP (WASL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details