Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 150 (Olfr150)

This Recombinant Mouse Olfactory receptor 150 (Olfr150) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 150, Odorant receptor M93, Olfactory receptor 171-18, Olfactory receptor 7I

UniProt

Q60895

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYSNQSRVTEFIISGLTNKPELQLPLFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMY FFLSSLSFIDLCYSTIITPKMLVNFVTTKNVISYQECMTQLYFFIAFVISECHMLAAMAY DRYVAICNPLLYNVTMSYQVCSWMVGGVYGMGFIGAAIHTFCMLRVVFCKDNIINHYFCD LFPLMELACSSTYVNEVVLLSLSAFNIFIPTLTILGSYIFIIISILRIKSTEGRFKAFST CSSHFSAVSVFFGSLAFMYLQPFSVSSKDKGKVSSVFYTTIVPMLNPMIYSLRNRDVKLA LNKLFQKKKFHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD86/B7-2 Protein (aa 1-239, His Tag)
PKSH031474 100 µg

Recombinant Human CD86/B7-2 Protein (aa 1-239, His Tag)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 RJ4,  20nm
GM-207-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 RJ4, 20nm

Sign In for Pricing
View Details
Ultrasonic Cleaner BULC-901
BULC-901 1 Unit

Ultrasonic Cleaner BULC-901

Sign In for Pricing
View Details
QuantiChrom™ Lipase Assay Kit
DLPS-100 100 Tests

QuantiChrom™ Lipase Assay Kit

Sign In for Pricing
View Details
TLR5 (N-term) Rabbit Polyclonal Antibody
AP11534PU-N 400 µL

TLR5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QPCR Sealing Film
P1001-Q 100 Units/Pack

QPCR Sealing Film

Sign In for Pricing
View Details