Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 150 (Olfr150)

This Recombinant Mouse Olfactory receptor 150 (Olfr150) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 150, Odorant receptor M93, Olfactory receptor 171-18, Olfactory receptor 7I

UniProt

Q60895

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYSNQSRVTEFIISGLTNKPELQLPLFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMY FFLSSLSFIDLCYSTIITPKMLVNFVTTKNVISYQECMTQLYFFIAFVISECHMLAAMAY DRYVAICNPLLYNVTMSYQVCSWMVGGVYGMGFIGAAIHTFCMLRVVFCKDNIINHYFCD LFPLMELACSSTYVNEVVLLSLSAFNIFIPTLTILGSYIFIIISILRIKSTEGRFKAFST CSSHFSAVSVFFGSLAFMYLQPFSVSSKDKGKVSSVFYTTIVPMLNPMIYSLRNRDVKLA LNKLFQKKKFHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH6A1 (NM_005589) Human Over-expression Lysate
LC401715 20 µg

ALDH6A1 (NM_005589) Human Over-expression Lysate

Sign In for Pricing
View Details
NY BR 1 (ANKRD30A) Human qPCR Primer Pair (NM_052997)
HP216573 200 Reactions

NY BR 1 (ANKRD30A) Human qPCR Primer Pair (NM_052997)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF740 conjugate, 0.1mg/mL
BNC741372-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HAGH Antibody
OC-154-01 50 μL

HAGH Antibody

Sign In for Pricing
View Details
HAGH Antibody
OC-154-02 100 µL

HAGH Antibody

Sign In for Pricing
View Details
HAGH Antibody
OC-154-03 1 mL

HAGH Antibody

Sign In for Pricing
View Details